Inbox Placement v2¶
A seed list is an object that provides the mailing list for your inbox placement test. It also acts as a container for all the results of those tests and will aggregate the stats of all the tests.
When you create a seed list you will be provided a mailing list. You may adjust
this mailing list as you see fit, but you must send to the target_email otherwise
a placement test will not be run.
Generate a seed list¶
POST /v4/inbox/seedlists
Generate a seed list. The available form fields are as follows:
| Field | Description |
|---|---|
| sending_domains | The sending domains that messages will come from. You may specify this multiple times. At least one is required. |
| name | The name that you would like to use for this seed list. |
| seed_filter | A regular expression that will be applied to addresses in the mailing list. |
curl -X POST https://api.mailgun.net/v4/inbox/seedlists \
-F 'sending_domains=domain.com' \
--user 'api:<YOUR_API_KEY>'
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode createSeedList() throws UnirestException {
HttpResponse <JsonNode> request = Unirest.post("https://api.mailgun.net/v4/inbox/seedlists")
.basicAuth("api", API_KEY)
.field("sending_domains", "domain.com")
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the inbox placement endpoint.
# Consider using the following php curl function.
function create_seed_list() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'POST');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v4/inbox/seedlists');
curl_setopt($ch, CURLOPT_POSTFIELDS, array(
'sending_domains'=> 'domain.com',
)
);
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def create_seed_list():
data = {'sending_domains': 'domain.com'}
return requests.post(
"https://api.mailgun.net/v4/inbox/seedlists", data=data
auth=('api', 'YOUR_API_KEY'))
def create_seed_list
data = {'sending_domains'=> 'domain.com' }
RestClient.post("https://api:YOUR_API_KEY" \
"@api.mailgun.net/v4/inbox/seedlists",
fields_hash.merge(data))
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class CreateInboxPlacementTest
{
public static void Main (string[] args)
{
Console.WriteLine (CreateSeedList ().Content.ToString ());
}
public static IRestResponse CreateSeedList ()
{
RestClient client = new RestClient ();
client.BaseUrl = new Uri ("https://api.mailgun.net/seedlists");
client.Authenticator =
new HttpBasicAuthenticator ("api", "YOUR_API_KEY");
RestRequest request = new RestRequest ();
request.AddParameter ("sending_domains", "YOUR_DOMAIN_NAME", ParameterType.UrlSegment);
request.Resource = "inbox/seedlists";
request.Method = Method.POST;
return client.Execute (request);
}
}
Example response for creating a seed list.
{
"kid": "610abd2009b08f382ac86c45",
"created_at": "2021-08-04T16:15:28.08Z",
"updated_at": "2021-08-04T16:15:28.08Z",
"last_result_at": "0001-01-01T00:00:00Z",
"target_email": "ibp-12345678-1234-1234-1234-123456789012@domain.com",
"sending_domains": [
"yourdomain.com"
],
"has_results": false,
"name": "My campaign inbox test",
"seed_filter": ".*",
"mailing_list": "ibp-12345678-1234-1234-1234-123456789012@domain.com,another@email.com",
"delivery_stats": {
"all": {
"delivered": 0,
"missing": 0,
"pending": 0,
"spam": 0,
"inbox": 0,
"total": 0,
"provider": "all"
}
},
"results": []
}
Field Explanation:
| Name | Type | Description |
|---|---|---|
| kid | string | Unique identifier for a seed list. |
| created_at | datetime | Date and time that seed list was created. |
| updated_at | datetime | Date and time that seed list was updated. Will update whenever it is changed. |
| last_result_at | datetime | Date and time that seed list was updated. Will update whenever a new result comes in. |
| target_email | string | The required email address that must be included in a mailing list for an inbox placement test to work. |
| sending_domains | array | The list of possible domains that the messages must come from. |
| has_results | bool | A flag that is true when results exist for this seed list |
| name | string | The name of the seed list |
| seed_filter | string | A regular expression value that will be used to filter the list of seeds in the seed list. |
| mailing_list | string | A mailing list that contains the target email, and available seeds. |
| delivery_stats | object | An object that contains sub-objects that describe delivery stats. See below. |
| results | array | An array of results from the seed list’s tests. |
Delivery Stats¶
Delivery stats is an object that is included with seed list and results from the API. It is an attribute of the main object that is returned. A sample object:
"delivery_stats": {
"all": {
"delivered": 10,
"missing": 1,
"pending": 0,
"spam": 3,
"inbox": 6,
"total": 10,
"provider": "all"
},
"yahoo.com": {
"delivered": 4,
"missing": 1,
"pending": 0,
"spam": 0,
"inbox": 4,
"total": 5,
"provider": "yahoo.com"
},
"gmail.com": {
"delivered": 5,
"missing": 0,
"pending": 0,
"spam": 3,
"inbox": 2,
"total": 5,
"provider": "gmail.com"
}
}
Field Explanation:
| Name | Type | Description |
|---|---|---|
| sub-object -“subkey” | object | The sub-object of the main delivery_stats object is divided by provider. There will always be an “all” provider that is the total sum. |
| delivered | number | The amount of messages that were received by the system. |
| missing | number | The amount of messages that were not received by the required reporting time period. |
| pending | number | The amount of messages that have yet to be received within the required reporting time period. |
| spam | number | The amount of messages that were detected in the provider’s spam folder. |
| inbox | number | The amount of messages that were detected in a non-spam folder. |
| total | number | The amount of messages that are expected. |
| provider | string | The provider that these mailboxes are a part of (identical to key). |
Results¶
A result is an object summarizing Inbox Placement tests sent to the target_email.
{
"result_id": "12345678-1234-1234-1234-123456789012",
"subject": "IBP Test - 1",
"sender": "generated@yourdomain.com",
"delivery_stats": {
"all": {
"delivered": 7,
"missing": 0,
"pending": 0,
"spam": 2,
"inbox": 5,
"total": 7,
"provider": "all",
"categories": {}
}
}
}
Field Explanation:
| Name | Type | Description |
|---|---|---|
| result_id | string | Unique identifier for a received test. |
| subject | string | The subject of the email sent to the target_email. |
| sender | string | Sender address of the email sent to the target_email. |
| delivery_stats | object | An object that contains sub-objects that describe delivery stats. See above. |
Get all seed lists¶
GET /v4/inbox/seedlists
Get a list of all of your seed lists. You can filter this using the available filters. These can be listed from the “Get all available filters for seed lists” endpoint described below.
curl -s --user 'api:YOUR_API_KEY' -G \
https://api.mailgun.net/v4/seedlists
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode getSeedLists() throws UnirestException {
HttpResponse<JsonNode> request = Unirest.get("https://api.mailgun.net/v4/inbox/seedlists")
.basicAuth("api", API_KEY)
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the Inbox Placement endpoint.
# Consider using the following php curl function.
function get_seed_lists() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'GET');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v4/inbox/seedlists');
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def get_seed_lists():
return requests.get(
"https://api.mailgun.net/v4/inbox/seedlists",
auth=('api', 'YOUR_API_KEY'))
def get_seed_lists
RestClient.get("https://api:YOUR_API_KEY"\
"@api.mailgun.net/v4/inbox/seedlists"\
{|response, request, result| response }
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class InboxPlacementTests
{
public static void Main (string[] args)
{
Console.WriteLine (GetSeedLists ().Content.ToString ());
}
public static IRestResponse GetSeedLists ()
{
RestClient client = new RestClient ();
client.BaseUrl = new Uri ("https://api.mailgun.net/v4");
client.Authenticator =
new HttpBasicAuthenticator ("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest ();
request.Resource = "/inbox/seedlists";
return client.Execute (request);
}
}
Example response for listing seed lists.
{
"items": [
{
"kid": "123456789123456789123456",
"created_at": "2021-08-02T23:10:17.915Z",
"updated_at": "2021-08-03T17:26:55.629Z",
"last_result_at": "2021-08-03T17:26:55.629Z",
"target_email": "ibp-12345678-1234-1234-1234-123456789012@domain.com",
"sending_domains": [
"mydomain.com"
],
"has_results": true,
"name": "Inbox Placement Test",
"seed_filter": ".*",
"mailing_list": "ibp-12345678-1234-1234-1234-123456789012@domain.com,some@where.com",
"delivery_stats": {
"all": {
"delivered": 7,
"missing": 0,
"pending": 0,
"spam": 2,
"inbox": 5,
"total": 7,
"provider": "all"
}
},
"results": [
{
"result_id": "12345678-1234-1234-1234-123456789012",
"subject": "IBP Test - 1",
"sender": "generated@yourdomain.com",
"delivery_stats": {
"all": {
"delivered": 7,
"missing": 0,
"pending": 0,
"spam": 2,
"inbox": 5,
"total": 7,
"provider": "all",
"categories": {}
}
}
}
]
}
],
"paging": {
"first": "http://domain.com/v4/inbox/seedlists?ascending=0&limit=1",
"last": "http://domain.com/v4/inbox/seedlists?ascending=1&limit=1",
"next": "http://domain.com/v4/inbox/seedlists?ascending=0&cursor=123987123981723987873497&limit=1",
"previous": "http://domain.com/v4/inbox/seedlists?ascending=1&cursor=123987123981723987873487&limit=1"
},
"total": 32
}
Field Explanation:
| Name | Type | Description |
|---|---|---|
| items | array | A list of seed list objects (same fields as above). |
| paging | object | A paging sub-object to navigate through sections of data. |
| total | number | The total amount of seed lists. |
Paging sub-object¶
The paging sub-object assists with navigating paginated responses. For a variety of reasons the number of items that can be returned in a response has been limited. This object contains the following fields:
| Name | Type | Description |
|---|---|---|
| first | url | A url address to the first item of this set |
| last | url | A url address to the last item of this set |
| next | url | A url address to the next item of this set |
| previous | url | A url address to the previous item of this set |
Additionally you can interact with the pagination through a few fields added to the query-string of your request:
| Name | Type | Description |
|---|---|---|
| limit | number | A limit on the number of items that can be returned (defaults to 25) |
| offset | number | A the amount of items to “move” by |
| ascending | bool | A flag that will set the order of the pagination |
| cursor | string | A unique id that can be used as a “pivot” of where you are in the set |
| sort | string | The parameter to sort by (EXPERIMENTAL) |
Note: cursor and offset may not both be used at the same time
Get a seed list¶
You can select a single seed list with this endpoint.
GET /v4/inbox/seedlists/ibp-seedlist-address@domain.net
curl -X POST https://api.mailgun.net/v3/inbox/tests \
-F 'domain=domain.com' \
-F 'subject=testSubject' \
-F 'from=user@sending_domain.com' \
--form-string html='<html>HTML version of the body</html>' \
--user 'api:<YOUR_API_KEY'>'
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode validateMailingList() throws UnirestException {
HttpResponse <JsonNode> request = Unirest.post("https://api.mailgun.net/v3/inbox/tests")
.basicAuth("api", API_KEY)
.field("domain", "domain.com")
.field("subject", "testSubject")
.field("from", "user@sending_domain.com")
.field("html", "<html>HTML version of the body</html>")
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the inbox placement endpoint.
# Consider using the following php curl function.
function create_inbox_placement_test() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'POST');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v3/inbox/tests');
curl_setopt($ch, CURLOPT_POSTFIELDS, array(
'domain'=> 'domain.com',
'from'=> 'user@sending_domain.com',
'subject'=>'testSubject',
'html'=>'<html>HTML version of the body</html>',
)
);
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def create_inbox_placement_test():
data = {'domain': 'domain.com',
'from': 'user@sending_domain.com',
'subject': 'testSubject',
'html': '<html>HTML version of the body</html>' }
return requests.post(
"https://api.mailgun.net/v3/inbox/tests", data=data
auth=('api', 'YOUR_API_KEY'))
def validate_mailing_list
data = {'domain'=> 'domain.com',
'from'=> 'user@sending_domain.com',
'subject'=> 'testSubject',
'html'=> '<html>HTML version of the body</html>' }
RestClient.post("https://api:YOUR_API_KEY" \
"@api.mailgun.net/v3/inbox/tests",
fields_hash.merge(data))
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class CreateInboxPlacementTest
{
public static void Main (string[] args)
{
Console.WriteLine (StartInboxPlacementTest ().Content.ToString ());
}
public static IRestResponse StartInboxPlacementTest ()
{
RestClient client = new RestClient ();
client.BaseUrl = new Uri ("https://api.mailgun.net/v3");
client.Authenticator =
new HttpBasicAuthenticator ("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest ();
request.AddParameter ("domain", "YOUR_DOMAIN_NAME", ParameterType.UrlSegment);
request.Resource = "inbox/tests";
request.AddParameter ("from", "user@sending_domain.com'");
request.AddParameter ("domain", "domain.com");
request.AddParameter ("subject", "testSubject");
request.AddParameter ("html", "<html>HTML version of the body</html>");
request.Method = Method.POST;
return client.Execute (request);
}
}
Example response of getting a single seed list.
{
"kid": "610abd2009b08f382ac86c45",
"created_at": "2021-08-04T16:15:28.08Z",
"updated_at": "2021-08-04T16:15:28.08Z",
"last_result_at": "0001-01-01T00:00:00Z",
"target_email": "ibp-seedlist-address@domain.net",
"sending_domains": [
"yourdomain.com"
],
"has_results": false,
"name": "My campaign inbox test",
"seed_filter": ".*",
"mailing_list": "ibp-seedlist-address@domain.net,another@email.com",
"delivery_stats": {
"all": {
"delivered": 0,
"missing": 0,
"pending": 0,
"spam": 0,
"inbox": 0,
"total": 0,
"provider": "all"
}
},
"results": [
{
"result_id": "12345678-1234-1234-1234-123456789012",
"subject": "IBP Test - 1",
"sender": "generated@yourdomain.com",
"delivery_stats": {
"all": {
"delivered": 7,
"missing": 0,
"pending": 0,
"spam": 2,
"inbox": 5,
"total": 7,
"provider": "all",
"categories": {}
}
}
}
]
}
| Name | Type | Description |
|---|---|---|
| kid | string | Unique identifier for a seed list. |
| created_at | datetime | Date and time that seed list was created. |
| updated_at | datetime | Date and time that seed list was updated. Will update whenever it is changed. |
| last_result_at | datetime | Date and time that seed list was updated. Will update whenever a new result comes in. |
| target_email | string | The required email address that must be included in a mailing list for an inbox placement test to work. |
| sending_domains | array | The list of possible domains that the messages must come from. |
| has_results | bool | A flag that is true when results exist for this seed list |
| name | string | The name of the seed list |
| seed_filter | string | A regular expression value that will be used to filter the list of seeds in the seed list. |
| mailing_list | string | A mailing list that contains the target email, and available seeds. |
| delivery_stats | object | An object that contains sub-objects that describe delivery stats. See below. |
| results | array | An array of results from the seed list’s tests. |
Get all iterable attributes of seed lists¶
You can use this endpoint to find all attributes that are available for listing values of.
GET /v4/inbox/seedlists/a
curl -s --user 'api:YOUR_API_KEY' -G \
https://api.mailgun.net/v4/inbox/seedlists/a
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode getSeedListAttributes() throws UnirestException {
HttpResponse<JsonNode> request = Unirest.get("https://api.mailgun.net/v4/inbox/seedlists/a")
.basicAuth("api", API_KEY)
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the inbox placement endpoint.
# Consider using the following php curl function.
function get_seed_list_attributes() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'GET');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v4/inbox/seedlists/a');
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def get_seed_list_attributes():
return requests.get(
"https://api.mailgun.net/v4/inbox/seedlists/a",
auth=('api', 'YOUR_API_KEY'))
def get_seed_list_attributes
RestClient.get("https://api:YOUR_API_KEY"\
"@api.mailgun.net/v4/inbox/seedlists/a"\
{|response, request, result| response }
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class InboxPlacementTest
{
public static void Main (string[] args)
{
Console.WriteLine (GetSeedListAttributes().Content.ToString());
}
public static IRestResponse GetSeedListAttributes()
{
RestClient client = new RestClient();
client.BaseUrl = new Uri("https://api.mailgun.net/v4");
client.Authenticator =
new HttpBasicAuthenticator("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest();
request.Resource = "/inbox/seedlists/a";
return client.Execute(request);
}
}
Example response of seed list attributes.
{
"items": {
"attribute": "available attributes",
"values": [
"name"
]
}
}
| Name | Type | Description |
|---|---|---|
| attribute | string | A string describing what was selected. |
| values | array | A list of attributes that can be retrieved from the API. |
Get all values of a specific attribute of your seed lists¶
You can use this endpoint to find all the values for a particular attribute. This can be used to produce autocomplete or suggestions from a frontend.
GET /v4/inbox/seedlists/a/attribute
curl -s --user 'api:YOUR_API_KEY' -G \
https://api.mailgun.net/v4/inbox/seedlists/a/ATTRIBUTE
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode getSeedListAttribute() throws UnirestException {
HttpResponse<JsonNode> request = Unirest.get("https://api.mailgun.net/v4/inbox/seedlists/a/ATTRIBUTE")
.basicAuth("api", API_KEY)
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the inbox placement endpoint.
# Consider using the following php curl function.
function get_seed_list_attribute() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'GET');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v4/inbox/seedlists/a/ATTRIBUTE');
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def get_seed_list_attribute():
return requests.get(
"https://api.mailgun.net/v4/inbox/seedlists/a/ATTRIBUTE",
auth=('api', 'YOUR_API_KEY'))
def get_seed_list_attribute
RestClient.get("https://api:YOUR_API_KEY"\
"@api.mailgun.net/v4/inbox/seedlists/a/ATTRIBUTE"\
{|response, request, result| response }
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class InboxPlacementTest
{
public static void Main (string[] args)
{
Console.WriteLine (GetSeedListAttribute().Content.ToString());
}
public static IRestResponse GetSeedListAttribute()
{
RestClient client = new RestClient();
client.BaseUrl = new Uri("https://api.mailgun.net/v4");
client.Authenticator =
new HttpBasicAuthenticator("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest();
request.AddParameter ("attribute", "ATTRIBUTE", ParameterType.UrlSegment);
request.Resource = "/inbox/seedlists/a/{attribute}";
return client.Execute(request);
}
}
Example response of seed list attribute values.
{
"items": {
"attribute": "name",
"values": [
"Inbox Placement Test",
"My email campaign"
]
}
}
| Name | Type | Description |
|---|---|---|
| attribute | string | A string describing what was selected. |
| values | array | A list of attributes that can be retrieved from the API. |
Get all available filters for seed lists¶
You can use this endpoint to list the available filters for seed lists.
GET /v4/inbox/seedlists/_filters
curl -s --user 'api:YOUR_API_KEY' -G \
https://api.mailgun.net/v4/inbox/seedlists/_filters
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode getSeedListFilters() throws UnirestException {
HttpResponse<JsonNode> request = Unirest.get("https://api.mailgun.net/v4/inbox/seedlists/_filters")
.basicAuth("api", API_KEY)
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the inbox placement endpoint.
# Consider using the following php curl function.
function get_seed_list_filters() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'GET');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v4/inbox/seedlists/_filters');
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def get_seed_list_filters():
return requests.get(
"https://api.mailgun.net/v4/inbox/seedlists/_filters",
auth=('api', 'YOUR_API_KEY'))
def get_seed_list_filters
RestClient.get("https://api:YOUR_API_KEY"\
"@api.mailgun.net/v4/inbox/seedlists/_filters"\
{|response, request, result| response }
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class InboxPlacementTest
{
public static void Main (string[] args)
{
Console.WriteLine (GetSeedListFilters().Content.ToString());
}
public static IRestResponse GetSeedListFilters()
{
RestClient client = new RestClient();
client.BaseUrl = new Uri("https://api.mailgun.net/v4");
client.Authenticator =
new HttpBasicAuthenticator("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest();
request.Resource = "/inbox/seedlists/_filters";
return client.Execute(request);
}
}
Example response of seed list filters.
{
"supported_filters": {
"filters": [
{
"parameter": "name",
"description": "Get seedlists by name"
},
{
"parameter": "time_before",
"description": "Get seedlists before date"
},
{
"parameter": "time_after",
"description": "Get seedlists after date"
}
]
}
}
| Name | Type | Description |
|---|---|---|
| parameter | string | The key of the parameter you can pass in your query string. |
| description | string | A description of the filter |
Delete a seed list¶
You can delete a seed list with this endpoint. The results under it will not be kept.
DELETE /v4/inbox/seedlists/ibp-seedlist-address@domain.net
curl -s --user 'api:YOUR_API_KEY' -X DELETE -G \
https://api.mailgun.net/v4/inbox/seedlists/TARGET_EMAIL
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode deleteInboxPlacementTest() throws UnirestException {
HttpResponse<JsonNode> request = Unirest.delete("https://api.mailgun.net/v4/inbox/seedlists/{TARGET_EMAIL}")
.basicAuth("api", API_KEY)
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the inbox placement endpoint.
# Consider using the following php curl function.
function delete_inbox_placement_test() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'DELETE');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v4/inbox/seedlists/TARGET_EMAIL');
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def delete_inbox_placement_test():
return requests.delete(
"https://api.mailgun.net/v4/inbox/seedlists/TARGET_EMAIL",
auth=('api', 'YOUR_API_KEY'))
def delete_inbox_placement_test
RestClient.delete("https://api:YOUR_API_KEY"\
"@api.mailgun.net/v4/inbox/seedlists/TARGET_EMAIL"\
{|response, request, result| response }
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class InboxPlacementTest
{
public static void Main (string[] args)
{
Console.WriteLine (GetInboxPlacementTest().Content.ToString());
}
public static IRestResponse DeleteInboxPlacementTest()
{
RestClient client = new RestClient();
client.BaseUrl = new Uri("https://api.mailgun.net/v4");
client.Authenticator =
new HttpBasicAuthenticator("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest(Method.DELETE);
request.AddParameter ("target_email", "TARGET_EMAIL", ParameterType.UrlSegment);
request.Resource = "/inbox/seedlists/{target_email}";
return client.Execute(request);
}
}
This does not return any value.
Update a seed list¶
You can update a seed list with this endpoint. Modifying the sending domains or the seed filter will not affect historical results.
PUT /v4/inbox/seedlists/ibp-seedlist-address@domain.net
Update a seed list. The available form fields are as follows:
| Field | Description |
|---|---|
| sending_domains | Update the sending domains of the seed list. You can specify this multiple times. |
| name | Update the name of the seed list. |
| seed_filter | Update the regular expression that will be applied to addresses in the mailing list. |
curl -X PUT https://api.mailgun.net/v4/inbox/seedlists/TARGET_EMAIL \
-F 'sending_domains=domain.com' \
--user 'api:<YOUR_API_KEY>'
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode createSeedList() throws UnirestException {
HttpResponse <JsonNode> request = Unirest.put("https://api.mailgun.net/v4/inbox/seedlists/TARGET_EMAIL")
.basicAuth("api", API_KEY)
.field("sending_domains", "domain.com")
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the inbox placement endpoint.
# Consider using the following php curl function.
function create_seed_list() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'PUT');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v4/inbox/seedlists/TARGET_EMAIL');
curl_setopt($ch, CURLOPT_POSTFIELDS, array(
'sending_domains'=> 'domain.com',
)
);
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def create_seed_list():
data = {'sending_domains': 'domain.com'}
return requests.put(
"https://api.mailgun.net/v4/inbox/seedlists/TARGET_EMAIL", data=data
auth=('api', 'YOUR_API_KEY'))
def create_seed_list
data = {'sending_domains'=> 'domain.com' }
RestClient.put("https://api:YOUR_API_KEY" \
"@api.mailgun.net/v4/inbox/seedlists/TARGET_EMAIL",
fields_hash.merge(data))
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class CreateInboxPlacementTest
{
public static void Main (string[] args)
{
Console.WriteLine (CreateSeedList ().Content.ToString ());
}
public static IRestResponse CreateSeedList ()
{
RestClient client = new RestClient ();
client.BaseUrl = new Uri ("https://api.mailgun.net/v4");
client.Authenticator =
new HttpBasicAuthenticator ("api", "YOUR_API_KEY");
RestRequest request = new RestRequest ();
request.AddParameter ("sending_domains", "YOUR_DOMAIN_NAME", ParameterType.UrlSegment);
request.Resource = "inbox/seedlists/TARGET_EMAIL";
request.Method = Method.PUT;
return client.Execute (request);
}
}
{
"kid": "610abd2009b08f382ac86c45",
"created_at": "2021-08-04T16:15:28.08Z",
"updated_at": "2021-08-04T16:15:28.08Z",
"last_result_at": "0001-01-01T00:00:00Z",
"target_email": "ibp-seedlist-address@domain.net",
"sending_domains": [
"yourdomain.com"
],
"has_results": false,
"name": "My campaign inbox test",
"seed_filter": ".*",
"mailing_list": "ibp-seedlist-address@domain.net,another@email.com",
"delivery_stats": {
"all": {
"delivered": 0,
"missing": 0,
"pending": 0,
"spam": 0,
"inbox": 0,
"total": 0,
"provider": "all"
}
},
"results": []
}
| Name | Type | Description |
|---|---|---|
| kid | string | Unique identifier for a seed list. |
| created_at | datetime | Date and time that seed list was created. |
| updated_at | datetime | Date and time that seed list was updated. Will update whenever it is changed. |
| last_result_at | datetime | Date and time that seed list was updated. Will update whenever a new result comes in. |
| target_email | string | The required email address that must be included in a mailing list for an inbox placement test to work. |
| sending_domains | array | The list of possible domains that the messages must come from. |
| has_results | bool | A flag that is true when results exist for this seed list |
| name | string | The name of the seed list |
| seed_filter | string | A regular expression value that will be used to filter the list of seeds in the seed list. |
| mailing_list | string | A mailing list that contains the target email, and available seeds. |
| delivery_stats | object | An object that contains sub-objects that describe delivery stats. See below. |
| results | array | An array of results from the seed list’s tests. |
List Results¶
Test results are generated when a message has been received at the target_email. If a message is not received at the target
email no seed test will be run. Results will contain the status of the monitored mail boxes and will provide stats of the test.
GET /v4/inbox/results
List all results for your account.
| Field | Description |
|---|---|
| rid | Update the sending domains of the seed list. You can specify this multiple times. |
| name | Update the name of the seed list. |
| seed_filter | Update the regular expression that will be applied to addresses in the mailing list. |
curl -s --user 'api:YOUR_API_KEY' -G \
https://api.mailgun.net/v4/inbox/results
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode getResults() throws UnirestException {
HttpResponse<JsonNode> request = Unirest.get("https://api.mailgun.net/v4/inbox/results")
.basicAuth("api", API_KEY)
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the Inbox Placement endpoint.
# Consider using the following php curl function.
function get_results() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'GET');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v4/inbox/results');
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def get_results():
return requests.get(
"https://api.mailgun.net/v4/inbox/results",
auth=('api', 'YOUR_API_KEY'))
def get_results
RestClient.get("https://api:YOUR_API_KEY"\
"@api.mailgun.net/v4/inbox/results"\
{|response, request, result| response }
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class InboxPlacementTests
{
public static void Main (string[] args)
{
Console.WriteLine (GetResults ().Content.ToString ());
}
public static IRestResponse GetResults ()
{
RestClient client = new RestClient ();
client.BaseUrl = new Uri ("https://api.mailgun.net/v4");
client.Authenticator =
new HttpBasicAuthenticator ("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest ();
request.Resource = "/inbox/results";
return client.Execute (request);
}
}
{
"items": [
{
"rid": "123456789012345678901234",
"result_id": "12345678-1234-1234-1234-123456789012",
"keybox_email": "ibp-00410325-1c95-492e-bc35-c19899802494@mailgun.net",
"subject": "A subject of things",
"sender": "person@domain.com",
"name": "Such list",
"created_at": "2021-08-03T14:20:40.301Z",
"updated_at": "2021-08-03T14:36:53.841Z",
"seed_results": [
{
"email": "mail@box.com",
"provider": "box.com",
"destination": "inbox",
"state": "delivered",
"originating_ip": "123.123.123.123",
"tags": [
"inbox"
]
}
]
}
]
}
| Name | Type | Description |
|---|---|---|
| rid | string | Unique identifier for a results. |
| keybox_email | string | The target email of the seed list associated with this result. |
| subject | string | The subject of the email received by the seed list mailbox (target_email) |
| sender | string | The email address of the sender received by the seed list mailbox (target_email). All other results must come from the same sender. |
| name | string | The name of the seed list. |
| created_at | datetime | Date and time that the results were created. |
| updated_at | datetime | Date and time that the results were updated. Will update whenever a mailbox within the test receives mail. |
| seed_results | object | A sub-object that contains the status of each individual seed mailbox. |
| status | string | Will show “processing” or “complete”. |
| delivery_stats | object | A sub-object that provides the stats of this result. |
Seed Results¶
The seed results sub-object will provide the details of the individual seed mail boxes.
Field Explanation:
| Name | Type | Description |
|---|---|---|
| string | The email address of the mailbox. | |
| provider | string | The email provider of the mailbox (usually the domain). |
| destination | string | Either “inbox” or “spam” |
| state | string | Whether or not the mailbox has received a message |
| originating_ip | string | The IP address from which the message came from (if available) |
| tags | array | The folder, or labels of where the message ended up. |
Get Available Result Filters¶
GET /v4/inbox/results/_filters
curl -s --user 'api:YOUR_API_KEY' -G \
https://api.mailgun.net/v4/results/_filters
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode getResultsFilters() throws UnirestException {
HttpResponse<JsonNode> request = Unirest.get("https://api.mailgun.net/v4/inbox/results/_filters")
.basicAuth("api", API_KEY)
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the Inbox Placement endpoint.
# Consider using the following php curl function.
function get_results_filters() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'GET');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v4/inbox/results/_filters');
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def get_results_filters():
return requests.get(
"https://api.mailgun.net/v4/inbox/results/_filters",
auth=('api', 'YOUR_API_KEY'))
def get_results_filters
RestClient.get("https://api:YOUR_API_KEY"\
"@api.mailgun.net/v4/inbox/results/_filters"\
{|response, request, result| response }
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class InboxPlacementTests
{
public static void Main (string[] args)
{
Console.WriteLine (GetResultsFilters ().Content.ToString ());
}
public static IRestResponse GetResultsFilters ()
{
RestClient client = new RestClient ();
client.BaseUrl = new Uri ("https://api.mailgun.net/v4");
client.Authenticator =
new HttpBasicAuthenticator ("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest ();
request.Resource = "/inbox/results/_filters";
return client.Execute (request);
}
}
Example response of getting the available results filters.
Get all iterable attributes of results¶
GET /v4/inbox/results/a
Example response of getting the result attributes.
Get all values of a specific attribute of your results lists¶
GET /v4/inbox/results/a/attribute
curl -s --user 'api:YOUR_API_KEY' -G \
https://api.mailgun.net/v4/inbox/results/a/ATTRIBUTE
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode getResultsAttribute() throws UnirestException {
HttpResponse<JsonNode> request = Unirest.get("https://api.mailgun.net/v4/inbox/results/a/ATTRIBUTE")
.basicAuth("api", API_KEY)
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the inbox placement endpoint.
# Consider using the following php curl function.
function get_results_attribute() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'GET');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v4/inbox/results/a/ATTRIBUTE');
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def get_results_attribute():
return requests.get(
"https://api.mailgun.net/v4/inbox/results/a/ATTRIBUTE",
auth=('api', 'YOUR_API_KEY'))
def get_results_attribute
RestClient.get("https://api:YOUR_API_KEY"\
"@api.mailgun.net/v4/inbox/results/a/ATTRIBUTE"\
{|response, request, result| response }
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class InboxPlacementTest
{
public static void Main (string[] args)
{
Console.WriteLine (GetResultsAttribute().Content.ToString());
}
public static IRestResponse GetResultsAttribute()
{
RestClient client = new RestClient();
client.BaseUrl = new Uri("https://api.mailgun.net/v4");
client.Authenticator =
new HttpBasicAuthenticator("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest();
request.AddParameter ("attribute", "ATTRIBUTE", ParameterType.UrlSegment);
request.Resource = "/inbox/results/a/{attribute}";
return client.Execute(request);
}
}
You can use this endpoint to find all the values for a particular attribute. This can be used to produce autocomplete or suggestions from a frontend.
Example response of response attribute values.
{
"items": {
"attribute": "subject",
"values": [
"This is a subject",
"We've been trying to contact you",
"about your car's extended warranty"
]
}
}
Get a specific result¶
GET /v4/inbox/results/UUID
curl -s --user 'api:YOUR_API_KEY' -G \
https://api.mailgun.net/v4/inbox/results/UUID
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode getResults() throws UnirestException {
HttpResponse<JsonNode> request = Unirest.get("https://api.mailgun.net/v4/inbox/results/{UUID}")
.basicAuth("api", API_KEY)
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the inbox placement endpoint.
# Consider using the following php curl function.
function get_results() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'GET');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v4/inbox/results/UUID');
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def get_results():
return requests.get(
"https://api.mailgun.net/v4/inbox/results/UUID",
auth=('api', 'YOUR_API_KEY'))
def get_results
RestClient.get("https://api:YOUR_API_KEY"\
"@api.mailgun.net/v4/inbox/results/UUID"\
{|response, request, result| response }
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class InboxPlacementTest
{
public static void Main (string[] args)
{
Console.WriteLine (GetResult().Content.ToString());
}
public static IRestResponse GetResult()
{
RestClient client = new RestClient();
client.BaseUrl = new Uri("https://api.mailgun.net/v4");
client.Authenticator =
new HttpBasicAuthenticator("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest();
request.AddParameter ("uuid", "UUID", ParameterType.UrlSegment);
request.Resource = "/inbox/results/{uuid}";
return client.Execute(request);
}
}
You can use this endpoint to get a single result.
| Name | Type | Description |
|---|---|---|
| rid | string | Unique identifier for a results. |
| keybox_email | string | The target email of the seed list associated with this result. |
| subject | string | The subject of the email received by the seed list mailbox (target_email) |
| sender | string | The email address of the sender received by the seed list mailbox (target_email). All other results must come from the same sender. |
| name | string | The name of the seed list. |
| created_at | datetime | Date and time that the results were created. |
| updated_at | datetime | Date and time that the results were updated. Will update whenever a mailbox within the test receives mail. |
| seed_results | object | A sub-object that contains the status of each individual seed mailbox. |
| status | string | Will show “processing” or “complete”. |
| delivery_stats | object | A sub-object that provides the stats of this result. |
{
"result": {
"rid": "123456789012345678901234",
"result_id": "12345678-1234-1234-1234-123456789012",
"keybox_email": "ibp-00410325-1c95-492e-bc35-c19899802494@mailgun.net",
"subject": "A subject of things",
"sender": "person@domain.com",
"name": "Such list",
"created_at": "2021-08-03T14:20:40.301Z",
"updated_at": "2021-08-03T14:36:53.841Z",
"seed_results": [
{
"email": "mail@box.com",
"provider": "box.com",
"destination": "inbox",
"state": "delivered",
"originating_ip": "123.123.123.123",
"tags": [
"inbox"
]
}
]
}
}
Delete results¶
Use this endpoint to delete a result.
DELETE /v4/inbox/results/UUID
curl -s --user 'api:YOUR_API_KEY' -X DELETE -G \
https://api.mailgun.net/v4/inbox/results/UUID
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode deleteResults() throws UnirestException {
HttpResponse<JsonNode> request = Unirest.delete("https://api.mailgun.net/v4/inbox/results/{UUID}")
.basicAuth("api", API_KEY)
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the inbox placement endpoint.
# Consider using the following php curl function.
function delete_results() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'DELETE');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v4/inbox/results/UUID');
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def delete_results():
return requests.delete(
"https://api.mailgun.net/v4/inbox/results/UUID",
auth=('api', 'YOUR_API_KEY'))
def delete_results
RestClient.delete("https://api:YOUR_API_KEY"\
"@api.mailgun.net/v4/inbox/results/UUID"\
{|response, request, result| response }
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class Results
{
public static void Main (string[] args)
{
Console.WriteLine (DeleteResults().Content.ToString());
}
public static IRestResponse DeleteResults()
{
RestClient client = new RestClient();
client.BaseUrl = new Uri("https://api.mailgun.net/v4");
client.Authenticator =
new HttpBasicAuthenticator("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest(Method.DELETE);
request.AddParameter ("uuid", "UUID", ParameterType.UrlSegment);
request.Resource = "/inbox/results/{uuid}";
return client.Execute(request);
}
}
This does not return any value.
Inbox Placement v1 Deprecated¶
Start an inbox placement test¶
POST /v3/inbox/tests
Start an inbox placement test. The required form fields are as follows.
| Field | Description |
|---|---|
| domain | The sending domain registered with mailgun to send the messages with. |
| subject | The subject associated with the message being tested. |
| html | The html that makes up the body of the message being tested. |
| from | The sending address associated with the sending of the message. |
curl -X POST https://api.mailgun.net/v3/inbox/tests \
-F 'domain=domain.com' \
-F 'subject=testSubject' \
-F 'from=user@sending_domain.com' \
--form-string html='<html>HTML version of the body</html>' \
--user 'api:<YOUR_API_KEY'>'
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode validateMailingList() throws UnirestException {
HttpResponse <JsonNode> request = Unirest.post("https://api.mailgun.net/v3/inbox/tests")
.basicAuth("api", API_KEY)
.field("domain", "domain.com")
.field("subject", "testSubject")
.field("from", "user@sending_domain.com")
.field("html", "<html>HTML version of the body</html>")
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the inbox placement endpoint.
# Consider using the following php curl function.
function create_inbox_placement_test() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'POST');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v3/inbox/tests');
curl_setopt($ch, CURLOPT_POSTFIELDS, array(
'domain'=> 'domain.com',
'from'=> 'user@sending_domain.com',
'subject'=>'testSubject',
'html'=>'<html>HTML version of the body</html>',
)
);
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def create_inbox_placement_test():
data = {'domain': 'domain.com',
'from': 'user@sending_domain.com',
'subject': 'testSubject',
'html': '<html>HTML version of the body</html>' }
return requests.post(
"https://api.mailgun.net/v3/inbox/tests", data=data
auth=('api', 'YOUR_API_KEY'))
def validate_mailing_list
data = {'domain'=> 'domain.com',
'from'=> 'user@sending_domain.com',
'subject'=> 'testSubject',
'html'=> '<html>HTML version of the body</html>' }
RestClient.post("https://api:YOUR_API_KEY" \
"@api.mailgun.net/v3/inbox/tests",
fields_hash.merge(data))
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class CreateInboxPlacementTest
{
public static void Main (string[] args)
{
Console.WriteLine (StartInboxPlacementTest ().Content.ToString ());
}
public static IRestResponse StartInboxPlacementTest ()
{
RestClient client = new RestClient ();
client.BaseUrl = new Uri ("https://api.mailgun.net/v3");
client.Authenticator =
new HttpBasicAuthenticator ("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest ();
request.AddParameter ("domain", "YOUR_DOMAIN_NAME", ParameterType.UrlSegment);
request.Resource = "inbox/tests";
request.AddParameter ("from", "user@sending_domain.com'");
request.AddParameter ("domain", "domain.com");
request.AddParameter ("subject", "testSubject");
request.AddParameter ("html", "<html>HTML version of the body</html>");
request.Method = Method.POST;
return client.Execute (request);
}
}
Example response for creating an inbox placement test.
{
"tid": "5e22167af8424f444ca6d8e2"
}
Field Explanation:
| Name | Type | Description |
|---|---|---|
| tid | string | Unique identifier for an inbox placement test. |
Get all inbox placement tests¶
This API endpoint is used for interfacing with the inbox placement service. Pricing details for Mailgun’s inbox placement service can be found on our pricing page. Mailgun’s inbox placement service is intended to be used for seed testing for emails. Refer to our Acceptable Use Policy (AUP) for more information about how to use the service appropriately.
GET /v3/inbox/tests
Retrieve a list of all the inbox placement tests and their results ran on the account.
curl -s --user 'api:YOUR_API_KEY' -G \
https://api.mailgun.net/v3/inbox/tests
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode getInboxPlacementTests() throws UnirestException {
HttpResponse<JsonNode> request = Unirest.get("https://api.mailgun.net/v3/inbox/tests")
.basicAuth("api", API_KEY)
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the Inbox Placement endpoint.
# Consider using the following php curl function.
function get_inbox_placement_tests() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'GET');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v3/inbox/tests');
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def get_inbox_placement_tests():
return requests.get(
"https://api.mailgun.net/v3/inbox/tests",
auth=('api', 'YOUR_API_KEY'))
def get_inbox_placement_tests
RestClient.get("https://api:YOUR_API_KEY"\
"@api.mailgun.net/v3/inbox/tests"\
{|response, request, result| response }
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class InboxPlacementTests
{
public static void Main (string[] args)
{
Console.WriteLine (GetInboxPlacementTests ().Content.ToString ());
}
public static IRestResponse GetInboxPlacementTests ()
{
RestClient client = new RestClient ();
client.BaseUrl = new Uri ("https://api.mailgun.net/v3");
client.Authenticator =
new HttpBasicAuthenticator ("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest ();
request.Resource = "/inbox/tests";
return client.Execute (request);
}
}
Example response of getting a list of inbox placement tests.
{
"paging": {
"first": "https://api.mailgun.net/v3/inbox/tests?ascending=0",
"last": "https://api.mailgun.net/v3/inbox/tests?ascending=1",
"next": "https://api.mailgun.net/v3/inbox/tests?ascending=0&cursor=5e22167af8424f444ca6d8ea",
"previous": "https://api.mailgun.net/v3/inbox/tests?ascending=1&cursor=5e22167af8424f444ca6d8e2"
},
"tests": [
{
"tid": "5e22167af8424f444ca6d8e2",
"counts": {
"inbox": 2,
"junk": 1,
"missing": 0
},
"domain": "ibp.voxcreator.com",
"status": "completed",
"seeds": [
"joesmith915@o365.mailgun.email",
"joesmith916@o365.mailgun.email",
"janedoe@o365.mailgun.email"
],
"start_time": "2020-01-17T20:18:02.093Z",
"end_time": "2020-01-17T20:33:02.097Z",
"summary": {
"stats": {
"averages": {
"mailgun_send": {
"inbox": 95.48,
"junk": 3.2,
"missing": 1.32
}
}
}
},
"subject": "This Service is Awesome!"
},
{
"tid": "5e22167af8424f444ca6d8ea",
"counts": {
"inbox": 2,
"junk": 1,
"missing": 0
},
"domain": "ibp.voxcreator.com",
"status": "completed",
"seeds": [
"joesmith915@o365.mailgun.email",
"joesmith916@o365.mailgun.email",
"janedoe@o365.mailgun.email"
],
"start_time": "2020-01-17T20:18:02.093Z",
"end_time": "2020-01-17T20:33:02.097Z",
"summary": {
"stats": {
"averages": {
"mailgun_send": {
"inbox": 95.48,
"junk": 3.2,
"missing": 1.32
}
}
}
},
"subject": "This Mail is Awesome!"
}
],
"total": 2
}
Field Explanation:
| Name | Type | Description |
|---|---|---|
| paging | object | Urls used to page through the list of inbox placement tests. |
| tests | array | List of inbox placement tests. |
| total | integer | Total number of inbox placement tests ran for the account |
Retrieve individual test details¶
GET /v3/inbox/tests/<test_id>
Retrieve a single inbox placement test.
| Parameter | Description |
|---|---|
| test_id | The unique identifier for the inbox placement test. |
curl -s --user 'api:YOUR_API_KEY' -G \
https://api.mailgun.net/v3/inbox/tests/TEST_ID
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode getInboxPlacementTest() throws UnirestException {
HttpResponse<JsonNode> request = Unirest.get("https://api.mailgun.net/v3/inbox/tests/{test_id}")
.basicAuth("api", API_KEY)
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the inbox placement endpoint.
# Consider using the following php curl function.
function get_inbox_placement_test() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'GET');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v3/inbox/tests/TEST_ID');
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def get_inbox_placement_test():
return requests.get(
"https://api.mailgun.net/v3/inbox/tests/TEST_ID",
auth=('api', 'YOUR_API_KEY'))
def get_inbox_placement_test
RestClient.get("https://api:YOUR_API_KEY"\
"@api.mailgun.net/v3/inbox/tests/TEST_ID"\
{|response, request, result| response }
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class InboxPlacementTest
{
public static void Main (string[] args)
{
Console.WriteLine (GetInboxPlacementTest().Content.ToString());
}
public static IRestResponse GetInboxPlacementTest()
{
RestClient client = new RestClient();
client.BaseUrl = new Uri("https://api.mailgun.net/v3");
client.Authenticator =
new HttpBasicAuthenticator("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest();
request.AddParameter ("test_id", "TEST_ID", ParameterType.UrlSegment);
request.Resource = "/inbox/tests/{test_id}";
return client.Execute(request);
}
}
Example response of getting an inbox placement test.
{
"tid": "5e22167af8424f444ca6d8e2",
"counts": {
"inbox": 2,
"junk": 1,
"missing": 0
},
"domain": "inbox_placement.domain.com",
"status": "completed",
"seeds": [
"joesmith915@o365.mailgun.email",
"joesmith916@o365.mailgun.email",
"janedoe@o365.mailgun.email"
],
"start_time": "2020-01-17T20:18:02.093Z",
"end_time": "2020-01-17T20:33:02.097Z",
"summary": {
"stats": {
"averages": {
"mailgun_send": {
"inbox": 95.48,
"junk": 3.2,
"missing": 1.32
}
}
}
},
"render_url": "https://mg-inbox-placement.s3.amazonaws.com/export/b156f44d9c27ee74422a3e38dd831343ec541938.png?X-Amz-Algorithm=AWS4-HMAC-SHA256&X-Amz-Credential=AKIAJR5LUWTPXYIVY4GA%2F20200118%2Fus-east-1%2Fs3%2Faws4_request&X-Amz-Date=20200118T225458Z&X-Amz-Expires=3600&X-Amz-SignedHeaders=host&X-Amz-Signature=f255b140f0efa94507bb62542b7a1191faaac708588edcb0d5dfd88a777e0061",
"subject": "This is an awesome API!"
}
Field Explanation:
| Name | Type | Description |
|---|---|---|
| tid | string | Unique identifier for an inbox placement test. |
| counts | object | Total counts for the mailboxes where the messages landed across the seed address sent to. |
| domain | string | The sending domain used to send the messages to the seed addresses. |
| status | string | The current status for a test. e.g. (“running”, “completed”, “error”, “created”) |
| seeds | array | The seed addresses the test message was sent to. |
| start_time | string | The time in which the inbox placement test began. |
| end_time | string | The time in which the inbox placement test ended. |
| summary | object | A summarized view of the inbox placement test. |
| rendered_url | string | A link to a rendered version of the message that was sent to the seed addresses. |
| subject | string | The subject for the message that was sent to the seed addresses. |
Delete an inbox placement test¶
DELETE /v3/inbox/tests/<test_id>
Delete a single inbox placement test.
| Parameter | Description |
|---|---|
| test_id | The unique identifier for the inbox placement test. |
curl -s --user 'api:YOUR_API_KEY' -X DELETE -G \
https://api.mailgun.net/v3/inbox/tests/TEST_ID
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode deleteInboxPlacementTest() throws UnirestException {
HttpResponse<JsonNode> request = Unirest.delete("https://api.mailgun.net/v3/inbox/tests/{test_id}")
.basicAuth("api", API_KEY)
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the inbox placement endpoint.
# Consider using the following php curl function.
function delete_inbox_placement_test() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'DELETE');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v3/inbox/tests/TEST_ID');
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def delete_inbox_placement_test():
return requests.delete(
"https://api.mailgun.net/v3/inbox/tests/TEST_ID",
auth=('api', 'YOUR_API_KEY'))
def delete_inbox_placement_test
RestClient.delete("https://api:YOUR_API_KEY"\
"@api.mailgun.net/v3/inbox/tests/TEST_ID"\
{|response, request, result| response }
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class InboxPlacementTest
{
public static void Main (string[] args)
{
Console.WriteLine (GetInboxPlacementTest().Content.ToString());
}
public static IRestResponse DeleteInboxPlacementTest()
{
RestClient client = new RestClient();
client.BaseUrl = new Uri("https://api.mailgun.net/v3");
client.Authenticator =
new HttpBasicAuthenticator("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest(Method.DELETE);
request.AddParameter ("test_id", "TEST_ID", ParameterType.UrlSegment);
request.Resource = "/inbox/tests/{test_id}";
return client.Execute(request);
}
}
Example response for deleting an inbox placement test.
{
"message": "deleted"
}
Retrieve provider results (counters) for a test¶
GET /v3/inbox/tests/<test_id>/counters
Retrieve a provider breakdown of the inbox placement test’s counters.
Parameter Description test_id The unique identifier for the inbox placement test.
curl -s --user 'api:YOUR_API_KEY' -G \
https://api.mailgun.net/v3/inbox/tests/TEST_ID/counters
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode getInboxPlacementTestCounters() throws UnirestException {
HttpResponse<JsonNode> request = Unirest.get("https://api.mailgun.net/v3/inbox/tests/{test_id}/counters")
.basicAuth("api", API_KEY)
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the inbox placement endpoint.
# Consider using the following php curl function.
function get_inbox_placement_test_counters() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'GET');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v3/inbox/tests/TEST_ID/counters');
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def get_inbox_placement_test_counters():
return requests.get(
"https://api.mailgun.net/v3/inbox/tests/TEST_ID/counters",
auth=('api', 'YOUR_API_KEY'))
def get_inbox_placement_test_counters
RestClient.get("https://api:YOUR_API_KEY"\
"@api.mailgun.net/v3/inbox/tests/TEST_ID/counters"\
{|response, request, result| response }
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class InboxPlacementTest
{
public static void Main (string[] args)
{
Console.WriteLine (GetInboxPlacementTestCounters().Content.ToString());
}
public static IRestResponse GetInboxPlacementTestCounters()
{
RestClient client = new RestClient();
client.BaseUrl = new Uri("https://api.mailgun.net/v3");
client.Authenticator =
new HttpBasicAuthenticator("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest();
request.AddParameter ("test_id", "TEST_ID", ParameterType.UrlSegment);
request.Resource = "/inbox/tests/{test_id}/counters";
return client.Execute(request);
}
}
Example response for inbox placement counters.
{
"counters": [
{
"inbox": 2,
"junk": 1,
"provider": "o365"
},
]
}
Field Explanation:
| Name | Type | Description |
|---|---|---|
| tid | string | Unique identifier for an inbox placement test. |
Get all inbox placement test checks¶
GET /v3/inbox/tests/<test_id>/checks
Retrieve a list of all the checks sent for an inbox placement test.
Parameter Description test_id The unique identifier for the inbox placement test.
curl -s --user 'api:YOUR_API_KEY' -G \
https://api.mailgun.net/v3/inbox/tests/TEST_ID/checks
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode getInboxPlacementTestCounters() throws UnirestException {
HttpResponse<JsonNode> request = Unirest.get("https://api.mailgun.net/v3/inbox/tests/{test_id}/checks")
.basicAuth("api", API_KEY)
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the inbox placement endpoint.
# Consider using the following php curl function.
function get_inbox_placement_test_checks() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'GET');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v3/inbox/tests/TEST_ID/checks');
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def get_inbox_placement_test_checks():
return requests.get(
"https://api.mailgun.net/v3/inbox/tests/TEST_ID/checks",
auth=('api', 'YOUR_API_KEY'))
def get_inbox_placement_test_checks
RestClient.get("https://api:YOUR_API_KEY"\
"@api.mailgun.net/v3/inbox/tests/TEST_ID/checks"\
{|response, request, result| response }
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class InboxPlacementTest
{
public static void Main (string[] args)
{
Console.WriteLine (GetInboxPlacementTestChecks().Content.ToString());
}
public static IRestResponse GetInboxPlacementTestChecks()
{
RestClient client = new RestClient();
client.BaseUrl = new Uri("https://api.mailgun.net/v3");
client.Authenticator =
new HttpBasicAuthenticator("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest();
request.AddParameter ("test_id", "TEST_ID", ParameterType.UrlSegment);
request.Resource = "/inbox/tests/{test_id}/checks";
return client.Execute(request);
}
}
Example response of getting a list of all checks for an inbox placement test.
{
"checks": [
{
"address": "aa_ext_test01mg@comcast.net",
"provider": "comcast",
"ip": "00.114.000.000",
"folder": "inbox",
"headers": "Return-Path: <bounce+b671ba.25af4b3-aa_ext_test01mg=comcast.net@test.domain.com>\r\nDelivered-To: aa_ext_test01mg@comcast.net\r\nReceived: from dovdir4-asa-04o.email.comcast.net ([96.114.154.247])\r\n\tby dovback4-asa-18o.email.comcast.net with LMTP\r\n\tid iD97DYUWIl58dAAAt8rViA\r\n\t(envelope-from <bounce+b671ba.25af4b3-aa_ext_test01mg=comcast.net@test.domain.com>)\r\n\tfor <aa_ext_test01mg@comcast.net>; Fri, 17 Jan 2020 20:18:13 +0000\r\nReceived: from dovpxy-asc-09o.email.comcast.net ([96.114.154.247])\r\n\tby dovdir4-asa-04o.email.comcast.net with LMTP\r\n\tid 2AU9DYUWIl79cAAAp4A1CQ\r\n\t(envelope-from <bounce+b671ba.25af4b3-aa_ext_test01mg=comcast.net@test.domain.com>)\r\n\tfor <aa_ext_test01mg@comcast.net>; Fri, 17 Jan 2020 20:18:13 +0000\r\nReceived: from resimta-po-40v.sys.comcast.net ([96.114.154.247])\r\n\t(using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits))\r\n\tby dovpxy-asc-09o.email.comcast.net with LMTP id IC0YMYMWIl5eOQAAquDo3w\r\n\t; Fri, 17 Jan 2020 20:18:13 +0000\r\nReceived: from so254-22.mailgun.net ([00.114.000.000])\r\n\tby resimta-po-40v.sys.comcast.net with ESMTP\r\n\tid sY4Iie8ttwt3TsY4KiR4U0; Fri, 17 Jan 2020 20:18:12 +0000\r\nX-CAA-SPAM: F00000\r\nX-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedugedrtdekgdegudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihenuceurghilhhouhhtmecufedttdenucenucfjughrpeffshfkvffhufgtggeshhhqredttddtvdenucfhrhhomhepuhhsvghrsehisghprdhvohigtghrvggrthhorhdrtghomhenucffohhmrghinhepmhgrihhlghhunhdrtghomhdpthifihhtthgvrhdrtghomhenucfkphepudelkedriedurddvheegrddvvdenucfrrghrrghmpehhvghlohepshhovdehgedqvddvrdhmrghilhhguhhnrdhnvghtpdhinhgvthepudelkedriedurddvheegrddvvddpmhgrihhlfhhrohhmpegsohhunhgtvgdosgeijedusggrrddvhegrfhegsgefqdgrrggpvgigthgpthgvshhttddumhhgpegtohhmtggrshhtrdhnvghtsehisghprdhvohigtghrvggrthhorhdrtghomhdprhgtphhtthhopegrrggpvgigthgpthgvshhttddumhhgsegtohhmtggrshhtrdhnvghtnecuvehluhhsthgvrhfuihiivgeptd\r\nX-Xfinity-VMeta: sc=0.00;st=legit\r\nX-Xfinity-Message-Heuristics: IPv6:N;TLS=1;SPF=1;DMARC=\r\nAuthentication-Results: resimta-po-40v.sys.comcast.net;\r\n\tdkim=pass header.d=test.domain.com header.b=NA9s3uW5\r\nDKIM-Signature: a=rsa-sha256; v=1; c=relaxed/relaxed; d=test.domain.com; q=dns/txt;\r\n s=k1; t=1579292292; h=Mime-Version: Content-Type: Subject: From: To:\r\n Message-Id: Sender: Date: Content-Transfer-Encoding;\r\n bh=bYuUQQIdEIrM6gyAxa1Xp4Nd0A2cWpdksHogCDsE+j8=; b=NA9s3uW5ejKsh0a/lDlEEfoKhyh8OevkRYfDau6tqRIYw/82eEWHxSRQrbTdKjxOWSH4ZHwl\r\n DpigSIhjF3Ub5BQdV64LtN8Bcd1ps/2exdIa21qiKewJDFQht9KoLURTCI5FY+03dywAIeM4\r\n yOp9o/cuQTKJH2qM4iiDgRE0Gsg=\r\nX-Mailgun-Sending-Ip: 00.114.000.000\r\nX-Mailgun-Sid: WyJjYTRiMyIsICJhYV9leHRfdGVzdDAxbWdAY29tY2FzdC5uZXQiLCAiMjVhZjRiMyJd\r\nContent-Transfer-Encoding: quoted-printable\r\nReceived: by luna.mailgun.net with HTTP; Fri, 17 Jan 2020 20:18:11 +0000\r\nDate: Fri, 17 Jan 2020 20:18:11 +0000\r\nSender: user@test.domain.com\r\nMessage-Id: <20200117201811.1.BDA3E43254369346@test.domain.com>\r\nX-Mailgun-Seed-Test-Id: 5e22167af8424f444ca6d8e2\r\nTo: aa_ext_test01mg@comcast.net\r\nFrom: user@test.domain.com\r\nSubject: testSubject\r\nContent-Type: text/html; charset=\"ascii\"\r\nMime-Version: 1.0",
"message_id": "<20200117201811.1.BDA3E43254369346@test.domain.com>",
"time": "2020-01-17T20:18:08.8Z"
},
{
"address": "aa_ext_test02mg@comcast.net",
"provider": "comcast",
"ip": "00.114.000.000",
"folder": "inbox",
"headers": "Return-Path: <bounce+1e9aa3.25af4b3-aa_ext_test02mg=comcast.net@test.domain.com>\r\nDelivered-To: aa_ext_test02mg@comcast.net\r\nReceived: from dovdir3-asa-01o.email.comcast.net ([96.114.154.247])\r\n\tby dovback3-asa-07o.email.comcast.net with LMTP\r\n\tid uCAWG4gWIl6IDgAAVWOgEw\r\n\t(envelope-from <bounce+1e9aa3.25af4b3-aa_ext_test02mg=comcast.net@test.domain.com>)\r\n\tfor <aa_ext_test02mg@comcast.net>; Fri, 17 Jan 2020 20:18:16 +0000\r\nReceived: from dovpxy-asc-01o.email.comcast.net ([96.114.154.247])\r\n\tby dovdir3-asa-01o.email.comcast.net with LMTP\r\n\tid 0CrqGogWIl7xTAAAwP0GGg\r\n\t(envelope-from <bounce+1e9aa3.25af4b3-aa_ext_test02mg=comcast.net@test.domain.com>)\r\n\tfor <aa_ext_test02mg@comcast.net>; Fri, 17 Jan 2020 20:18:16 +0000\r\nReceived: from resimta-po-40v.sys.comcast.net ([96.114.154.247])\r\n\t(using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits))\r\n\tby dovpxy-asc-01o.email.comcast.net with LMTP id OD4qI4UWIl5UQQAAyeh4YQ\r\n\t; Fri, 17 Jan 2020 20:18:16 +0000\r\nReceived: from so254-22.mailgun.net ([00.114.000.000])\r\n\tby resimta-po-40v.sys.comcast.net with ESMTP\r\n\tid sY4Iie8ttwt3TsY4MiR4WV; Fri, 17 Jan 2020 20:18:16 +0000\r\nX-CAA-SPAM: F00000\r\nX-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedugedrtdekgdegudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihenuceurghilhhouhhtmecufedttdenucenucfjughrpeffshfkvffhufgtggeshhhqredttddtvdenucfhrhhomhepuhhsvghrsehisghprdhvohigtghrvggrthhorhdrtghomhenucffohhmrghinhepmhgrihhlghhunhdrtghomhdpthifihhtthgvrhdrtghomhenucfkphepudelkedriedurddvheegrddvvdenucfrrghrrghmpehhvghlohepshhovdehgedqvddvrdhmrghilhhguhhnrdhnvghtpdhinhgvthepudelkedriedurddvheegrddvvddpmhgrihhlfhhrohhmpegsohhunhgtvgdoudgvlegrrgefrddvhegrfhegsgefqdgrrggpvgigthgpthgvshhttddvmhhgpegtohhmtggrshhtrdhnvghtsehisghprdhvohigtghrvggrthhorhdrtghomhdprhgtphhtthhopegrrggpvgigthgpthgvshhttddvmhhgsegtohhmtggrshhtrdhnvghtnecuvehluhhsthgvrhfuihiivgeptd\r\nX-Xfinity-VMeta: sc=0.00;st=legit\r\nX-Xfinity-Message-Heuristics: IPv6:N;TLS=1;SPF=1;DMARC=\r\nAuthentication-Results: resimta-po-40v.sys.comcast.net;\r\n\tdkim=pass header.d=test.domain.com header.b=J/in82+r\r\nDKIM-Signature: a=rsa-sha256; v=1; c=relaxed/relaxed; d=test.domain.com; q=dns/txt;\r\n s=k1; t=1579292296; h=Mime-Version: Content-Type: Subject: From: To:\r\n Message-Id: Sender: Date: Content-Transfer-Encoding;\r\n bh=bYuUQQIdEIrM6gyAxa1Xp4Nd0A2cWpdksHogCDsE+j8=; b=J/in82+rjjHVoVLeZIlYl+9y7WFgUOcXlrt+P8gaGduSdCEc6MEWMmY8JHyI0X00OTOLRIqn\r\n 1me6suiWiv8F2ADgtK2H9PYwRNg5LomNBKn7j1UbdQP4C7oJ3eYtvA6DCA5KRkgsHOTHY+Kq\r\n /S49D6ajqrN4ZyB+XTLnA5IN8ew=\r\nX-Mailgun-Sending-Ip: 00.114.000.000\r\nX-Mailgun-Sid: WyJlOThhZiIsICJhYV9leHRfdGVzdDAybWdAY29tY2FzdC5uZXQiLCAiMjVhZjRiMyJd\r\nContent-Transfer-Encoding: quoted-printable\r\nReceived: by luna.mailgun.net with HTTP; Fri, 17 Jan 2020 20:18:09 +0000\r\nDate: Fri, 17 Jan 2020 20:18:09 +0000\r\nSender: user@test.domain.com\r\nMessage-Id: <20200117201809.1.82C23D86DE20410C@test.domain.com>\r\nX-Mailgun-Seed-Test-Id: 5e22167af8424f444ca6d8e2\r\nTo: aa_ext_test02mg@comcast.net\r\nFrom: user@test.domain.com\r\nSubject: testSubject\r\nContent-Type: text/html; charset=\"ascii\"\r\nMime-Version: 1.0",
"message_id": "<20200117201809.1.82C23D86DE20410C@test.domain.com>",
"time": "2020-01-17T20:18:08.8Z"
}
]
}
Field Explanation:
| Name | Type | Description |
|---|---|---|
| checks | array | Collection of checks that represent the messages sent to the seed mailboxes. |
Get a single inbox placement test check¶
GET /v3/inbox/tests/<test_id>/checks/<address>
Retrieve a check sent for an inbox placement test.
Parameter Description test_id The unique identifier for the inbox placement test. address The seed address sent to in the inbox placement test.
curl -s --user 'api:YOUR_API_KEY' -G \
https://api.mailgun.net/v3/inbox/tests/TEST_ID/checks/ADDRESS
import com.mashape.unirest.http.HttpResponse;
import com.mashape.unirest.http.JsonNode;
import com.mashape.unirest.http.Unirest;
import com.mashape.unirest.http.exceptions.UnirestException;
public class MGSample {
// ...
public static JsonNode getInboxPlacementTestCheck() throws UnirestException {
HttpResponse<JsonNode> request = Unirest.get("https://api.mailgun.net/v3/inbox/tests/{test_id}/checks/{address}")
.basicAuth("api", API_KEY)
.asJson();
return request.getBody();
}
}
# Currently, the PHP SDK does not support the inbox placement endpoint.
# Consider using the following php curl function.
function get_inbox_placement_test() {
$ch = curl_init();
curl_setopt($ch, CURLOPT_HTTPAUTH, CURLAUTH_BASIC);
curl_setopt($ch, CURLOPT_USERPWD, 'api:PRIVATE_API_KEY');
curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1);
curl_setopt($ch, CURLOPT_CUSTOMREQUEST, 'GET');
curl_setopt($ch, CURLOPT_URL, 'https://api.mailgun.net/v3/inbox/tests/TEST_ID/checks/ADDRESS');
$result = curl_exec($ch);
curl_close($ch);
return $result;
}
def get_inbox_placement_test_check():
return requests.get(
"https://api.mailgun.net/v3/inbox/tests/TEST_ID/checks/ADDRESS",
auth=('api', 'YOUR_API_KEY'))
def get_inbox_placement_test_check
RestClient.get("https://api:YOUR_API_KEY"\
"@api.mailgun.net/v3/inbox/tests/TEST_ID/checks/ADDRESS"\
{|response, request, result| response }
end
using System;
using System.IO;
using RestSharp;
using RestSharp.Authenticators;
public class InboxPlacementTest
{
public static void Main (string[] args)
{
Console.WriteLine (GetInboxPlacementTestCheck().Content.ToString());
}
public static IRestResponse GetInboxPlacementTestCheck()
{
RestClient client = new RestClient();
client.BaseUrl = new Uri("https://api.mailgun.net/v3");
client.Authenticator =
new HttpBasicAuthenticator("api",
"YOUR_API_KEY");
RestRequest request = new RestRequest();
request.AddParameter ("test_id", "TEST_ID", ParameterType.UrlSegment);
request.AddParameter ("address", "ADDRESS", ParameterType.UrlSegment);
request.Resource = "/inbox/tests/{test_id}/checks/{address}";
return client.Execute(request);
}
}
Example response of getting a single check for an inbox placement test.
{
"address": "aa_ext_test02mg@comcast.net",
"provider": "comcast",
"ip": "96.114.154.247",
"folder": "inbox",
"headers": "Return-Path: <bounce+1e9aa3.25af4b3-aa_ext_test02mg=comcast.net@test.domain.com>\r\nDelivered-To: aa_ext_test02mg@comcast.net\r\nReceived: from dovdir3-asa-01o.email.comcast.net ([96.114.154.247])\r\n\tby dovback3-asa-07o.email.comcast.net with LMTP\r\n\tid uCAWG4gWIl6IDgAAVWOgEw\r\n\t(envelope-from <bounce+1e9aa3.25af4b3-aa_ext_test02mg=comcast.net@test.domain.com>)\r\n\tfor <aa_ext_test02mg@comcast.net>; Fri, 17 Jan 2020 20:18:16 +0000\r\nReceived: from dovpxy-asc-01o.email.comcast.net ([96.114.154.247])\r\n\tby dovdir3-asa-01o.email.comcast.net with LMTP\r\n\tid 0CrqGogWIl7xTAAAwP0GGg\r\n\t(envelope-from <bounce+1e9aa3.25af4b3-aa_ext_test02mg=comcast.net@test.domain.com>)\r\n\tfor <aa_ext_test02mg@comcast.net>; Fri, 17 Jan 2020 20:18:16 +0000\r\nReceived: from resimta-po-40v.sys.comcast.net ([96.114.154.247])\r\n\t(using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits))\r\n\tby dovpxy-asc-01o.email.comcast.net with LMTP id OD4qI4UWIl5UQQAAyeh4YQ\r\n\t; Fri, 17 Jan 2020 20:18:16 +0000\r\nReceived: from so254-22.mailgun.net ([198.61.254.22])\r\n\tby resimta-po-40v.sys.comcast.net with ESMTP\r\n\tid sY4Iie8ttwt3TsY4MiR4WV; Fri, 17 Jan 2020 20:18:16 +0000\r\nX-CAA-SPAM: F00000\r\nX-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedugedrtdekgdegudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihenuceurghilhhouhhtmecufedttdenucenucfjughrpeffshfkvffhufgtggeshhhqredttddtvdenucfhrhhomhepuhhsvghrsehisghprdhvohigtghrvggrthhorhdrtghomhenucffohhmrghinhepmhgrihhlghhunhdrtghomhdpthifihhtthgvrhdrtghomhenucfkphepudelkedriedurddvheegrddvvdenucfrrghrrghmpehhvghlohepshhovdehgedqvddvrdhmrghilhhguhhnrdhnvghtpdhinhgvthepudelkedriedurddvheegrddvvddpmhgrihhlfhhrohhmpegsohhunhgtvgdoudgvlegrrgefrddvhegrfhegsgefqdgrrggpvgigthgpthgvshhttddvmhhgpegtohhmtggrshhtrdhnvghtsehisghprdhvohigtghrvggrthhorhdrtghomhdprhgtphhtthhopegrrggpvgigthgpthgvshhttddvmhhgsegtohhmtggrshhtrdhnvghtnecuvehluhhsthgvrhfuihiivgeptd\r\nX-Xfinity-VMeta: sc=0.00;st=legit\r\nX-Xfinity-Message-Heuristics: IPv6:N;TLS=1;SPF=1;DMARC=\r\nAuthentication-Results: resimta-po-40v.sys.comcast.net;\r\n\tdkim=pass header.d=test.domain.com header.b=J/in82+r\r\nDKIM-Signature: a=rsa-sha256; v=1; c=relaxed/relaxed; d=test.domain.com; q=dns/txt;\r\n s=k1; t=1579292296; h=Mime-Version: Content-Type: Subject: From: To:\r\n Message-Id: Sender: Date: Content-Transfer-Encoding;\r\n bh=bYuUQQIdEIrM6gyAxa1Xp4Nd0A2cWpdksHogCDsE+j8=; b=J/in82+rjjHVoVLeZIlYl+9y7WFgUOcXlrt+P8gaGduSdCEc6MEWMmY8JHyI0X00OTOLRIqn\r\n 1me6suiWiv8F2ADgtK2H9PYwRNg5LomNBKn7j1UbdQP4C7oJ3eYtvA6DCA5KRkgsHOTHY+Kq\r\n /S49D6ajqrN4ZyB+XTLnA5IN8ew=\r\nX-Mailgun-Sending-Ip: 198.61.254.22\r\nX-Mailgun-Sid: WyJlOThhZiIsICJhYV9leHRfdGVzdDAybWdAY29tY2FzdC5uZXQiLCAiMjVhZjRiMyJd\r\nContent-Transfer-Encoding: quoted-printable\r\nReceived: by luna.mailgun.net with HTTP; Fri, 17 Jan 2020 20:18:09 +0000\r\nDate: Fri, 17 Jan 2020 20:18:09 +0000\r\nSender: user@test.domain.com\r\nMessage-Id: <20200117201809.1.82C23D86DE20410C@test.domain.com>\r\nX-Mailgun-Seed-Test-Id: 5e22167af8424f444ca6d8e2\r\nTo: aa_ext_test02mg@comcast.net\r\nFrom: user@test.domain.com\r\nSubject: testSubject\r\nContent-Type: text/html; charset=\"ascii\"\r\nMime-Version: 1.0",
"message_id": "<20200117201809.1.82C23D86DE20410C@test.domain.com>",
"time": "2020-01-17T20:18:08.8Z"
}
Field Explanation:
| Name | Type | Description |
|---|---|---|
| address | string | The address used to check for a test message. |
| provider | string | The provider responsible for maintaining the address. |
| ip | string | The ip the test message was sent from. |
| folder | string | The folder the test message landed in. |
| headers | string | The headers attached to the test message when retrieved from the address |
| message_id | string | The unique identifier attached to the test message when it is sent. |
| time | string | The time in which the message arrived at the address. |